ID  P83722;
PN  Nuclear pore complex protein Nup160;
GN  nup160;
OS  8355;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0185;
SL  Comments: Nucleus, nuclear pore complex {ECO:0000269|PubMed:11684705}. Cytoplasm {ECO:0000269|PubMed:11684705}.
DR  UNIPROT: P83722;
DE  Function: Functions as a component of the nuclear pore complex (NPC) (PubMed:11684705). Involved in poly(A)+ RNA transport (PubMed:11684705). {ECO:0000269|PubMed:11684705, ECO:0000303|PubMed:11684705}.
DE  Reference Proteome: Yes;
DE  Interaction: Q5EWX9; IntAct: EBI-8070373; Score: 0.35
GO  GO:0005737;
GO  GO:0031080;
GO  GO:0051028;
GO  GO:0015031;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  PVNIYVIMADQGPAHLPVSLAVHTDMLEYVPVSKDEYFQKLKKA
//