ID  P87310;
PN  Mediator of RNA polymerase II transcription subunit 10;
GN  med10;
OS  284812;
SL  Nucleus Position: SL-0178;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:16823372}. Nucleus {ECO:0000269|PubMed:16823372}. Nucleus envelope {ECO:0000269|PubMed:16823372}.
DR  UNIPROT: P87310;
DR  PDB: 5N9J;
DR  Pfam: PF09748;
DE  Function: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
DE  Reference Proteome: Yes;
DE  Interaction: Q9P7Y4; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: P87306; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: O14198; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: Q9Y7N2; IntAct: EBI-1533334; Score: 0.66
DE  Interaction: Q09696; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: O94376; IntAct: EBI-1533334; Score: 0.66
DE  Interaction: O14010; IntAct: EBI-1533334; Score: 0.66
DE  Interaction: Q10477; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: Q9Y821; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: Q9US45; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: O60104; IntAct: EBI-1533334; Score: 0.74
DE  Interaction: O94646; IntAct: EBI-1533334; Score: 0.66
DE  Interaction: Q09191; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: Q92399; IntAct: EBI-1533334; Score: 0.40
DE  Interaction: P48011; IntAct: EBI-1533334; Score: 0.40
DE  Interaction: P87123; IntAct: EBI-1533334; Score: 0.40
DE  Interaction: P36594; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: Q02061; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: P37382; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: O74825; IntAct: EBI-1533334; Score: 0.40
DE  Interaction: O14459; IntAct: EBI-1533334; Score: 0.59
DE  Interaction: P36595; IntAct: EBI-1533749; Score: 0.59
DE  Interaction: P68336; IntAct: EBI-1533613; Score: 0.35
DE  Interaction: Q9P6Q0; IntAct: EBI-26372760; Score: 0.52
DE  Interaction: Q10317; IntAct: EBI-26372760; Score: 0.52
DE  Interaction: Q9USH1; IntAct: EBI-26372760; Score: 0.52
DE  Interaction: O13964; IntAct: EBI-26372760; Score: 0.52
GO  GO:0000785;
GO  GO:0005829;
GO  GO:0016592;
GO  GO:0005635;
GO  GO:0005634;
GO  GO:0003713;
GO  GO:0003712;
GO  GO:0045944;
GO  GO:0060261;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MLPQDDMTDEMKSLASRLEDTTQAFYDLALIVYNLEDTTPSDAIPESLDTLIRDLKSLPDISRKVNNLIPQDVLEYIEQG
SQ  RNPDVYARQFSELVQKDNQYVNGKLYAIEGFQKAFAEEIKQAYPEVSSVVDKILNEGKVESTVS
//