ID  P89443;
PN  Protein UL20;
GN  UL20;
OS  10315;
SL  Nucleus Position: SL-0415;
SL  Nucleus Position: SL-0418;
SL  Comments: Virion {ECO:0000250}. Host cell membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Host endosome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Host Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Host nucleus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported with gK to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN) (By similarity). {ECO:0000250}.
DR  UNIPROT: P89443;
DR  Pfam: PF04544;
DE  Function: Plays an essential role in egress of virus particles from the nucleus, cytoplasmic envelopment and virus-induced cell fusion. Forms a functional protein complex with gK and this interaction is absolutely essential for their coordinate intracellular transport, gK glycosylation, expression on host cell surface, and function. Together, they modulate gB-mediated virus-induced cell fusion and virion egress and therefore actively participate in these processes (By similarity). {ECO:0000250}.
DE  Reference Proteome: Yes;
GO  GO:0044175;
GO  GO:0044178;
GO  GO:0044200;
GO  GO:0020002;
GO  GO:0016021;
GO  GO:0044423;
GO  GO:0019058;
TP  Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255};
SQ  MTMRDDVPLLDRELVDEAACGGEDGELPLDEQFSLSSYGTSDFFVSSAYSRLPPHTQPVFSKRVVMFAWSFLVLKPLELV
SQ  AAGMYYGWTGRAVAPACIIAAVLAYYVTWLARALLLYVNIKRDRLPLSPPVFWGLCVIMGGAALCALVAAAHETFSPDGL
SQ  FHWITASQLLPRTDPLRARSLGIACAAGAAMWVAAADCFAAFTNFFLARFWTRAILKAPVAF
//