ID  Q02647;
PN  Dynein light chain 1, cytoplasmic;
GN  DYN2;
OS  559292;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0185;
SL  Comments: Cytoplasm, cytoskeleton. Nucleus, nuclear pore complex {ECO:0000269|PubMed:17546040, ECO:0000269|PubMed:23223634, ECO:0000269|PubMed:25646085}.
DR  UNIPROT: Q02647;
DR  UNIPROT: D6VT54;
DR  PDB: 4DS1;
DR  PDB: 4HT6;
DR  PDB: 7N9F;
DR  Pfam: PF01221;
DR  PROSITE: PS01239;
DE  Function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity). Also a component of the nuclear pore complex where it may contribute to the stable association of the Nup82 subcomplex with the NPC (PubMed:17546040, PubMed:23223634, PubMed:25646085). {ECO:0000250, ECO:0000269|PubMed:17546040, ECO:0000269|PubMed:23223634, ECO:0000269|PubMed:25646085}.
DE  Reference Proteome: Yes;
DE  Interaction: P36161; IntAct: EBI-8466751; Score: 0.40
DE  Interaction: P40960; IntAct: EBI-8480342; Score: 0.81
DE  Interaction: P40494; IntAct: EBI-2613029; Score: 0.35
DE  Interaction: P24869; IntAct: EBI-2617071; Score: 0.35
DE  Interaction: P32589; IntAct: EBI-3724582; Score: 0.35
DE  Interaction: Q8IYA8; IntAct: EBI-11534278; Score: 0.56
DE  Interaction: O96015; IntAct: EBI-11534269; Score: 0.56
DE  Interaction: Q02647; IntAct: EBI-15483402; Score: 0.44
DE  Interaction: P36022; IntAct: EBI-15483422; Score: 0.43
GO  GO:0005737;
GO  GO:0005868;
GO  GO:0005881;
GO  GO:0005635;
GO  GO:0034399;
GO  GO:0005643;
GO  GO:1990429;
GO  GO:0045505;
GO  GO:0044877;
GO  GO:0040001;
GO  GO:0000132;
GO  GO:0051028;
GO  GO:0030473;
GO  GO:0051292;
GO  GO:0006913;
GO  GO:0015031;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSDENKSTPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNTWHVIVGKNFGSYVTHEKGHFVYFY
SQ  IGPLAFLVFKTA
//