ID  Q04827;
PN  G1/S-specific cyclin-D2;
GN  Ccnd2;
OS  10116;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0182;
SL  Comments: Nucleus {ECO:0000250|UniProtKB:P30279}. Cytoplasm {ECO:0000250|UniProtKB:P30279}. Nucleus membrane {ECO:0000250|UniProtKB:P30279}. Note=Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members. {ECO:0000250|UniProtKB:P30279}.
DR  UNIPROT: Q04827;
DR  Pfam: PF02984;
DR  Pfam: PF00134;
DR  PROSITE: PS00292;
DE  Function: Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. {ECO:0000250|UniProtKB:P30279}.
DE  Reference Proteome: Yes;
GO  GO:0000785;
GO  GO:0097129;
GO  GO:0000307;
GO  GO:0005737;
GO  GO:0005829;
GO  GO:0031965;
GO  GO:0005730;
GO  GO:0005634;
GO  GO:0016538;
GO  GO:0019901;
GO  GO:0008344;
GO  GO:0051301;
GO  GO:0071549;
GO  GO:0071372;
GO  GO:0071378;
GO  GO:0032869;
GO  GO:0071394;
GO  GO:0071481;
GO  GO:0000082;
GO  GO:0001889;
GO  GO:0007616;
GO  GO:0044772;
GO  GO:0043066;
GO  GO:2000726;
GO  GO:0001541;
GO  GO:0060045;
GO  GO:0008284;
GO  GO:0045737;
GO  GO:0050679;
GO  GO:1900087;
GO  GO:0001934;
GO  GO:0051726;
GO  GO:0000079;
GO  GO:0045664;
GO  GO:0051591;
GO  GO:0032355;
GO  GO:0043627;
GO  GO:0045471;
GO  GO:0032354;
GO  GO:0044752;
GO  GO:0014070;
GO  GO:0043434;
GO  GO:0033574;
GO  GO:0007283;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAM
SQ  NYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIE
SQ  HILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVNALTCDALTELLTKITHTDVD
SQ  CLKACQEQIEAVLLNSLQQFRQEQHNGSKSVEDPDQATTPTDVRDVDL
//