ID Q08931; PN Pheromone-regulated membrane protein 3; GN PRM3; OS 559292; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Nucleus outer membrane; Single-pass membrane protein; Cytoplasmic side. Cytoplasm, cytoskeleton, microtubule organizing center, spindle pole body. DR UNIPROT: Q08931; DR UNIPROT: D6W3H6; DE Function: Required for the fusion of nuclear envelopes during mating, ensuring proper karyogamy. Plays a role in the initiation of outer nuclear envelope fusion. {ECO:0000269|PubMed:12514182, ECO:0000269|PubMed:19297527, ECO:0000269|PubMed:19570912}. DE Reference Proteome: Yes; DE Interaction: P38987; IntAct: EBI-391647; Score: 0.37 DE Interaction: Q08931; IntAct: EBI-392676; Score: 0.37 DE Interaction: P38555; IntAct: EBI-392733; Score: 0.37 DE Interaction: P32602; IntAct: EBI-394017; Score: 0.37 DE Interaction: Q99260; IntAct: EBI-394311; Score: 0.37 DE Interaction: P38074; IntAct: EBI-856087; Score: 0.00 DE Interaction: P40857; IntAct: EBI-856585; Score: 0.00 DE Interaction: P47088; IntAct: EBI-856681; Score: 0.00 GO GO:0005737; GO GO:0031316; GO GO:0016021; GO GO:0005635; GO GO:0034399; GO GO:0005816; GO GO:0000742; GO GO:0048288; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MTAMKEDNAALITLKKNNDQEKLRVHKLTDASSNSADGFVINKAKNGGPLNKKSLVNNEQHIKKAVSPGRVRKHKTTTSS SQ TKSRTKSKKKDASESKVQRENKGSFYQGAIFGSFLGAAVTTVLSNLAVKALQN //