ID Q08CK7; PN Insulin-like growth factor 2 mRNA-binding protein 1; GN igf2bp1; OS 7955; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250}. Cytoplasm {ECO:0000250}. Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm, P-body {ECO:0000250|UniProtKB:Q9NZI8}. Cytoplasm, Stress granule {ECO:0000250|UniProtKB:Q9NZI8}. Cell projection, growth cone {ECO:0000250}. Cell projection, filopodium {ECO:0000250}. Cell projection, lamellipodium {ECO:0000250}. DR UNIPROT: Q08CK7; DR Pfam: PF00013; DR Pfam: PF00076; DR PROSITE: PS50084; DR PROSITE: PS50102; DE Function: RNA-binding factor that recruits target transcripts to cytoplasmic protein-RNA complexes (mRNPs). This transcript 'caging' into mRNPs allows mRNA transport and transient storage. It also modulates the rate and location at which target transcripts encounter the translational apparatus and shields them from endonuclease attacks or microRNA-mediated degradation. Preferentially binds to N6- methyladenosine (m6A)-containing mRNAs and increases their stability (By similarity). Plays a direct role in the transport and translation of transcripts required for axonal regeneration in adult sensory neurons (By similarity). Regulates localized beta-actin/ACTB mRNA translation in polarized cells, a crucial process for cell migration and neurite outgrowth. Promotes the directed movement of cells by fine- tuning intracellular signaling networks and enhances the velocity of cell migration (By similarity). {ECO:0000250|UniProtKB:Q9NZI8}. DE Reference Proteome: Yes; GO GO:0070937; GO GO:0005737; GO GO:0010494; GO GO:0005829; GO GO:0030175; GO GO:0030426; GO GO:0030027; GO GO:0005634; GO GO:0000932; GO GO:0048471; GO GO:0003730; GO GO:0003729; GO GO:1990247; GO GO:0070934; GO GO:0051028; GO GO:0007399; GO GO:0003407; GO GO:0010468; GO GO:0051252; GO GO:0006417; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MNKLYIGNLNEKVTAEDLVKTFEDYKIPYSGQFLMKTGYASVDCPDDQWAMKAIETFSGKVELHGKRIEVEHSVPKKQRT SQ RKLQIRNIPPHLQWEVLDGLLAQYGTVENCEQVNTDSETAVVNVTYGTREQARQAIQKLNGYQFDNNALRVSYIPDENSE SQ VDSQRGPDNGRRPGYGPRGTSRQMSPGSGIPSKHQHADIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENA SQ GAAEKPISIHSTPEGCSAACRMILEIMNQEAKDTKTADEVPLKVLAHNNFVGRLIGKEGRNLKKVEQDTDTKITISPLQD SQ LTLYNPERTITVKGSIEACCLAEQEIMKKVREAYDNDIAAMNQQTHLIPGLNLGAIGLFPPSSAMPPPALGNSVPGPPYG SQ PMGASEQETVHVYIPAQAVGALIGKKGQHIKQLSRFAGASIKIAPAEAPDSKMRMVIVTGPPEAQFKAQGRIYGKLKEEN SQ FFGPKEEVKLETHIKVAAAAAGRVIGKGGKTVNELQNLTAAEVVVPREQTPDEHDQVIVKIIGHFYASQLAQRKIRDILT SQ QVKQQQKGGGMGTPQGPHPQGMTELGSPQGLAQEPRRK //