ID Q0III6; PN DnaJ homolog subfamily B member 6; GN DNAJB6; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O75190}. Nucleus {ECO:0000250|UniProtKB:O75190}. Cytoplasm, myofibril, sarcomere, Z line {ECO:0000250|UniProtKB:O75190}. DR UNIPROT: Q0III6; DR UNIPROT: Q8WN90; DR Pfam: PF00226; DR PROSITE: PS00636; DR PROSITE: PS50076; DE Function: Plays an indispensable role in the organization of KRT8/KRT18 filaments. Acts as an endogenous molecular chaperone for neuronal proteins including huntingtin. Suppresses aggregation and toxicity of polyglutamine-containing, aggregation-prone proteins (By similarity). Has a stimulatory effect on the ATPase activity of HSP70 in a dose- dependent and time-dependent manner and hence acts as a co-chaperone of HSP70. Also reduces cellular toxicity and caspase-3 activity (By similarity). {ECO:0000250, ECO:0000269|PubMed:11896048}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:0030018; GO GO:0051087; GO GO:0044183; GO GO:0051082; GO GO:0061077; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MVDYYEVLGVQRHASAEDIKKAYRKLALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDRYGKEGLNGGGGGG SQ SHFDSPFEFGFTFRNPEDVFREFFGGRDPFSFDFFEDPFEDFFGHRRGPRGSRSRGTGSFFSTFSGFPSFGGAFPSFDAG SQ FSSFGSLGHGGLTAFSSSSAFGGSGMGNYKSISTSTKVVNGRKITTKRIVENGQERVEVEEDGQLKSLTINGKEQLLRLD SQ NK //