ID Q0VBL3; PN RNA-binding protein 15; GN Rbm15; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus speckle {ECO:0000250|UniProtKB:Q96T37}. Nucleus, nucleoplasm {ECO:0000269|PubMed:17283045}. Nucleus envelope {ECO:0000250|UniProtKB:Q96T37}. Nucleus membrane {ECO:0000250|UniProtKB:Q96T37}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q96T37}. Note=Colocalizes at the nuclear pore with DBP5 and NXF1. {ECO:0000250|UniProtKB:Q96T37}. DR UNIPROT: Q0VBL3; DR UNIPROT: A0PJG5; DR UNIPROT: Q3THK4; DR UNIPROT: Q3TLX0; DR UNIPROT: Q571M7; DR UNIPROT: Q66JP8; DR UNIPROT: Q6PGG1; DR UNIPROT: Q7TT82; DR Pfam: PF00076; DR Pfam: PF07744; DR PROSITE: PS50102; DR PROSITE: PS50917; DE Function: RNA-binding protein that acts as a key regulator of N6- methyladenosine (m6A) methylation of RNAs, thereby regulating different processes, such as hematopoietic cell homeostasis, alternative splicing of mRNAs and X chromosome inactivation mediated by Xist RNA (PubMed:29535189). Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing (PubMed:29535189). Plays a key role in m6A methylation, possibly by binding target RNAs and recruiting the WMM complex (PubMed:29535189). Involved in random X inactivation mediated by Xist RNA: acts by binding Xist RNA and recruiting the WMM complex, which mediates m6A methylation, leading to target YTHDC1 reader on Xist RNA and promoting transcription repression activity of Xist (By similarity). Required for the development of multiple tissues, such as the maintenance of the homeostasis of long-term hematopoietic stem cells and for megakaryocyte (MK) and B-cell differentiation (PubMed:17283045, PubMed:17376872, PubMed:18981216, PubMed:25468569). Regulates megakaryocyte differentiation by regulating alternative splicing of genes important for megakaryocyte differentiation; probably regulates alternative splicing via m6A regulation (By similarity). Required for placental vascular branching morphogenesis and embryonic development of the heart and spleen (PubMed:18981216). Acts as a regulator of thrombopoietin response in hematopoietic stem cells by regulating alternative splicing of MPL (PubMed:25468569). May also function as an mRNA export factor, stimulating export and expression of RTE-containing mRNAs which are present in many retrotransposons that require to be exported prior to splicing (By similarity). High affinity binding of pre-mRNA to RBM15 may allow targeting of the mRNP to the export helicase DBP5 in a manner that is independent of splicing- mediated NXF1 deposition, resulting in export prior to splicing (By similarity). May be implicated in HOX gene regulation (By similarity). {ECO:0000250|UniProtKB:Q96T37, ECO:0000269|PubMed:17283045, ECO:0000269|PubMed:17376872, ECO:0000269|PubMed:18981216, ECO:0000269|PubMed:25468569, ECO:0000269|PubMed:29535189}. DE Reference Proteome: Yes; DE Interaction: P49452; IntAct: EBI-8573213; Score: 0.35 DE Interaction: P52927; IntAct: EBI-9986179; Score: 0.35 DE Interaction: P70326; IntAct: EBI-16360068; Score: 0.35 DE Interaction: Q3UL36; IntAct: EBI-26888124; Score: 0.35 GO GO:0031965; GO GO:0016607; GO GO:0005654; GO GO:0005634; GO GO:0036396; GO GO:0003729; GO GO:0003723; GO GO:0001569; GO GO:0009048; GO GO:0045638; GO GO:0000122; GO GO:0060674; GO GO:0007221; GO GO:0000381; GO GO:0045652; GO GO:0001510; GO GO:0048536; GO GO:0038163; GO GO:0060412; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q96T37}; SQ MRSAGREPLPRRSPRWRRASPLCETSAGWRVSQLRRDDLRRPSTMKGKERSPVKPKRSRGGEDSSSRGERSKKLGGSGGS SQ NGSSSGKTDSGGSRRSLHLDKSSSRGGSREYETGGGSSSSRLHSYSSPSTKNSSGGGESRSSSRGGGGESRSSGAASSAP SQ GGGDGVEYKTLKISELGSQLSDEAVEDGLFHEFKRFGDVSVKISHLSGSGSGDERVAFVNFRRPEDARAAKHARGRLVLY SQ DRPLKIEAVYVSRRRSRSPLDKDAYAPSSSVVGTSVGSHRHAPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPP SQ PLPRELERERDYPFYDRVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFLGNLDITVTENDLRRAFDRFGVIT SQ EVDIKRPSRGQTSTYGFLKFENLDMSHRAKLAMSGKIIIRNPIKIGYGKATPTTRLWVGGLGPWVPLAALAREFDRFGTI SQ RTIDYRKGDSWAYIQYESLDAAHAAWTHMRGFPLGGPDRRLRVDFADTEHRYQQQYLQPLPLTHYELVTDTFGHRAPDPL SQ RSARDRTPPLLYRDRDRDLYTDSDWVPPPPPVRERSARAATSAVTAYEPLDSLDRRRDGWSLDRDRGDRDLPSSRDQPRK SQ RRLPEESGGRHLDRSPESERPRKQRHCTPSPDRSPELSSNRDRYNSDNDRSSRLLLLERSSPVRDRRGSLEKSQSDKRDR SQ KNSASAERDRKHRTAAPTEGKNPLKKEDRSDGNAPSASTSSSKQKPPSQKQDGGTAPVAASSPKLCLAWQGMLLLKNSNF SQ PSNMHLLQGDLQVASSLLVEGSTGGKVAQLKITQRLRLDQPKLDEVTRRIKVAGPNGYAILLAVPGSSDSRSSSSSATSD SQ TAASTQRPLRNLVSYLKQKQAAGVISLPVGGNKDKENTGVLHAFPPCEFSQQFLDSPAKALAKSEEDYLVMIIVRAKLVN SQ SG //