ID Q15004; PN PCNA-associated factor; GN PCLAF; OS 9606; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000269|PubMed:11313979, ECO:0000269|PubMed:16288740, ECO:0000269|PubMed:21673012, ECO:0000269|PubMed:23000965}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:21673012}. Note=Following DNA damage, localizes to DNA damage sites (PubMed:21628590). Colocalizes with centrosomes in perinuclear region (PubMed:21673012). DR UNIPROT: Q15004; DR UNIPROT: A6NNU5; DR UNIPROT: A8K3Y3; DR UNIPROT: G9G694; DR UNIPROT: G9G696; DR PDB: 4D2G; DR PDB: 6EHT; DR PDB: 6GWS; DR PDB: 6IIW; DR Pfam: PF15715; DR OMIM: 610696; DR DisGeNET: 9768; DE Function: PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork- blocking lesions. Also acts as a regulator of centrosome number. {ECO:0000269|PubMed:21673012, ECO:0000269|PubMed:23000965}. DE Reference Proteome: Yes; DE Interaction: P17918; IntAct: EBI-10999136; Score: 0.35 DE Interaction: P12004; IntAct: EBI-11109663; Score: 0.74 DE Interaction: P54274; IntAct: EBI-24714227; Score: 0.56 DE Interaction: Q8IYD8; IntAct: EBI-21821472; Score: 0.35 DE Interaction: P38936; IntAct: EBI-21259335; Score: 0.35 GO GO:0005813; GO GO:0005654; GO GO:0005634; GO GO:0048471; GO GO:0003682; GO GO:0060090; GO GO:0006974; GO GO:0007098; GO GO:0006260; GO GO:0051726; GO GO:0009411; GO GO:0019985; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKEN SQ QIPEEAGSSGLGKAKRKACPLQPDHTNDEKE //