ID  Q19541;
PN  Protein pid-1;
GN  pid;
OS  6239;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:24696453, ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}. Nucleus {ECO:0000269|PubMed:24696453}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}. Note=Expressed predominantly in the cytoplasm (PubMed:24696453). A small fraction is nuclear or located near the nucleus (PubMed:24696453). Dispersedly distributes throughout the cytoplasm in early embryos (PubMed:31147388). Localizes to puncta in the perinuclear region in the germline syncytium (PubMed:31216475, PubMed:31147388). {ECO:0000269|PubMed:24696453, ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}.
DR  UNIPROT: Q19541;
DE  Function: Component of the pid-1 variant of the PETISCO complex which is required for the biogenesis of a class of 21 nucleotide PIWI- interacting RNAs (piRNAs) that possess a uracil residue at the 5'-end (also called 21U-RNAs) (PubMed:31147388, PubMed:31216475). Within the complex acts as an adapter which binds to the complex via erh-2 (PubMed:31147388). Involved in the biogenesis of 21U-RNAs which guide the piwi protein prg-1 to its DNA targets for silencing (PubMed:24696453, PubMed:33231880). Plays a role in small RNA-directed transgenerational epigenetic inheritance (PubMed:33231880). {ECO:0000269|PubMed:24696453, ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:33231880, ECO:0000305|PubMed:31216475}.
DE  Reference Proteome: Yes;
DE  Interaction: O61955; IntAct: EBI-21448974; Score: 0.46
DE  Interaction: O76616; IntAct: EBI-21448974; Score: 0.56
DE  Interaction: Q09293; IntAct: EBI-21448974; Score: 0.46
DE  Interaction: Q22640; IntAct: EBI-21448974; Score: 0.35
DE  Interaction: Q18244; IntAct: EBI-21448974; Score: 0.35
DE  Interaction: Q9U2X0; IntAct: EBI-21448974; Score: 0.46
DE  Interaction: O62102; IntAct: EBI-21448974; Score: 0.35
DE  Interaction: Q27488; IntAct: EBI-21448974; Score: 0.46
DE  Interaction: Q20057; IntAct: EBI-21448974; Score: 0.55
DE  Interaction: Q21962; IntAct: EBI-21449552; Score: 0.35
DE  Interaction: P91477; IntAct: EBI-21449552; Score: 0.35
GO  GO:0005737;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0034518;
GO  GO:0034585;
GO  GO:0031047;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSAKREFSHITLASTPFKKRIDQNSLKTDSDIEKDTNIAHKCAERFNYNTNLHRKVTLSDRFELAALGYEMKAKPRTIIE
SQ  KHNDCDEFHFIYRKEKKNDYGTGSPLSAGLSLSNPLPAGRGFLSPAIQNTSNQFTFSGSPRITPQKHTPVSANHKPARSI
SQ  FDDIPSNIA
//