ID Q19972; PN Chromo domain-containing protein cec-4; GN cec; OS 6239; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Nucleus inner membrane {ECO:0000269|PubMed:26607792}. Membrane {ECO:0000305|PubMed:26607792}; Peripheral membrane protein {ECO:0000305|PubMed:26607792}. DR UNIPROT: Q19972; DR Pfam: PF00385; DR PROSITE: PS50013; DE Function: Chromatin anchor protein which binds to methylated lysine residues on histone H3, thereby recruiting heterochromatin to the nuclear periphery, especially in embryonic cells, with a lesser role in differentiated cells (PubMed:26607792, PubMed:31118512). May be required for the correct positioning of chromatin and nucleoli in embryos (PubMed:26607792). {ECO:0000269|PubMed:26607792, ECO:0000269|PubMed:31118512}. DE Reference Proteome: Yes; GO GO:0000793; GO GO:0005637; GO GO:0003682; GO GO:0035064; GO GO:0097240; GO GO:0045595; GO GO:0010468; TP Membrane Topology: Peripheral; Source: UniProt - Curator Inference {ECO:0000305|PubMed:26607792}; SQ MAKKTVEGEHGTPKTNFTKKETSKNHDDFKKIIGHKVVEEHYVEYEVELTSGKTITATEFDFKGDDSLLSTYKKKVTKQS SQ DDSSGEYAVERVLAHRKVKGSPLYLVQWKGYPHPVWNSEMWEEDLDNCKDLLAAYKKHQEDLKIAQTPKKTPSKTPKKTP SQ KSLKRRALTPSDDEEEAGPIAPEPKKTPKQSTKKLKRTTSPETNLVEKSKKKAIPDLENHTLDQEKNDVIERVEEIQEDE SQ DDDDEQREEVVTTAPVETKSRWGFGSWKWF //