ID  Q20057;
PN  Enhancer of rudimentary homolog 2;
GN  erh;
OS  6239;
SL  Nucleus Position: SL-0198;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}. Nucleus {ECO:0000269|PubMed:31216475}. Note=Dispersedly distributes throughout the cytoplasm in early embryos (PubMed:31147388). During early embryogenesis, localizes to the nucleus at prophase of cell division, and remains in the cytosol at interphase in 2- and 4-cell embryos (PubMed:31216475). Localizes to puncta in the perinuclear region in the germline syncytium (PubMed:31216475, PubMed:31147388). {ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475}.
DR  UNIPROT: Q20057;
DR  PDB: 7EJO;
DR  PDB: 7EJS;
DR  PDB: 7O6L;
DR  PDB: 7O6N;
DR  Pfam: PF01133;
DE  Function: Required for chromosome segregation and cell division in early embryos (PubMed:31216475). Component of the pid-1 and tost-1 variants of the PETISCO complexes, which have roles in the biogenesis of a class of 21 nucleotide PIWI-interacting RNAs (piRNAs) that possess a uracil residue at the 5'-end (also called 21U-RNAs) and embryogenesis, respectively (PubMed:31147388, PubMed:31216475). Within the tost-1 variant of the PETISCO complex binds to splice leader SL1 RNA fragments to possibly play a role in their processing (PubMed:31147388). Promotes the biogenesis of 21U-RNAs (PubMed:31216475). {ECO:0000269|PubMed:31147388, ECO:0000269|PubMed:31216475, ECO:0000305|PubMed:31216475}.
DE  Reference Proteome: Yes;
DE  Interaction: O61955; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: O76616; IntAct: EBI-21449031; Score: 0.48
DE  Interaction: Q09293; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q19541; IntAct: EBI-21448974; Score: 0.55
DE  Interaction: Q17698; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q8T3B7; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q9BL06; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q20140; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q20848; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q22537; IntAct: EBI-21449069; Score: 0.35
DE  Interaction: Q18490; IntAct: EBI-21449069; Score: 0.48
DE  Interaction: Q20057; IntAct: EBI-21449848; Score: 0.37
GO  GO:0005737;
GO  GO:0005634;
GO  GO:0048471;
GO  GO:0034518;
GO  GO:0034585;
GO  GO:0007049;
GO  GO:0051301;
GO  GO:0007059;
GO  GO:0009792;
GO  GO:0031047;
GO  GO:1990511;
GO  GO:0051781;
GO  GO:0051984;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSTSSHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKKSAAPVTYDVSQVYEFLDKLSDVSMMIFNRETGQY
SQ  IGRTRAWIKQQVYEMMRGRCQHPEGGEKVIVGY
//