ID  Q22663;
PN  Globin-like protein 26;
GN  glb;
OS  6239;
SL  Nucleus Position: SL-0178;
SL  Nucleus Position: SL-0180;
SL  Comments: Cytoplasm {ECO:0000269|PubMed:20361867, ECO:0000269|PubMed:23251335}. Nucleus lamina {ECO:0000269|PubMed:20361867, ECO:0000269|PubMed:23251335}. Cell membrane {ECO:0000269|PubMed:20361867, ECO:0000269|PubMed:23251335}. Note=Transported to the nucleus by myristoylation of the N-terminal glycine. {ECO:0000269|PubMed:20361867, ECO:0000269|PubMed:23251335}.
DR  UNIPROT: Q22663;
DR  Pfam: PF00042;
DE  Function: Plays a role in electron transport. Utilizes the bis-histidyl hexacoordinated complex with iron to transfer electrons to cytochrome c and molecular oxygen. Plays a regulatory role in the periodicity of the defecation cycle under oxidative stress conditions. Not involved in imparting protection against general conditions of oxidative stress. May participate in redox reactions under anaerobic conditions. {ECO:0000269|PubMed:20361867, ECO:0000269|PubMed:21674044, ECO:0000269|PubMed:23251335}.
DE  Reference Proteome: Yes;
GO  GO:0005737;
GO  GO:0016020;
GO  GO:0005652;
GO  GO:0005886;
GO  GO:0020037;
GO  GO:0046872;
GO  GO:0019825;
GO  GO:0005344;
GO  GO:0015671;
GO  GO:0001666;
TP  Membrane Topology: Lipid-Anchored; Source: UniProt - Experimental Evidence {ECO:0000269|PubMed:23251335};
SQ  MGSSTSTPAPPPKKNKPEGRKADNQILNSYQKSIVRNAWRHMSQKGPSNCGSTITRRMMARKSTIGDILDRSTLDYHNLQ
SQ  IVEFLQKVMQSLDEPDKISKLCQEIGQKHAKYRRSKGMKIDYWDKLGEAITETIREYQGWKIHRESLRAATVLVSYVVDQ
SQ  LRFGYSRGLHVQGSRETKEDDEE
//