ID Q29238; PN Chloride intracellular channel protein 1; GN CLIC1; OS 9823; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus {ECO:0000250}. Nucleus membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Cytoplasm {ECO:0000250}. Cell membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Note=Mostly in the nucleus including in the nuclear membrane. Small amount in the cytoplasm and the plasma membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity). {ECO:0000250}. DR UNIPROT: Q29238; DR Pfam: PF13409; DE Function: Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0034707; GO GO:0005737; GO GO:0016020; GO GO:0031965; GO GO:0005886; GO GO:0005254; GO GO:0005244; GO GO:0006821; GO GO:0051726; GO GO:0034765; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKI SQ EEFLEAVLCPPRYPKLAALNPESNTAGLDI //