ID Q2HJ92; PN Interferon-inducible double-stranded RNA-dependent protein kinase activator A; GN PRKRA; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250}. Cytoplasm {ECO:0000250}. DR UNIPROT: Q2HJ92; DR Pfam: PF00035; DR Pfam: PF16482; DR PROSITE: PS50137; DE Function: Activates EIF2AK2/PKR in the absence of double-stranded RNA (dsRNA), leading to phosphorylation of EIF2S1/EFI2-alpha and inhibition of translation and induction of apoptosis. Required for siRNA production by DICER1 and for subsequent siRNA-mediated post- transcriptional gene silencing. Does not seem to be required for processing of pre-miRNA to miRNA by DICER1. Promotes UBC9-p53/TP53 association and sumoylation and phosphorylation of p53/TP53 at 'Lys- 386' at 'Ser-392' respectively and enhances its activity in a EIF2AK2/PKR-dependent manner (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005829; GO GO:0005622; GO GO:0005654; GO GO:0005634; GO GO:0048471; GO GO:0016442; GO GO:0070578; GO GO:0003725; GO GO:0008047; GO GO:0019899; GO GO:0070883; GO GO:0042803; GO GO:0035197; GO GO:0034599; GO GO:0042474; GO GO:0042473; GO GO:2001244; GO GO:0031054; GO GO:0006468; GO GO:0050821; GO GO:0070920; GO GO:0030422; GO GO:0048705; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSQSRHRAAAPPMEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRVTVGDITCTGE SQ GTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYT SQ TICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNMVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTD SQ YIQLLSEIAKEQGFNITYLDIEELSANGQYQCLAELSTSPITVCHGSGISCSSAQSDAAHNALQYLKIIAERK //