ID Q2KHV7; PN Ubiquitin carboxyl-terminal hydrolase 2; GN USP2; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:O88623}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O88623}. Note=Localizes in the spermatid head in late-elongating spermatids in the thin area between the outer acrosomal membrane and the plasma membrane. {ECO:0000250|UniProtKB:Q5U349}. DR UNIPROT: Q2KHV7; DR Pfam: PF00443; DR PROSITE: PS00972; DR PROSITE: PS00973; DR PROSITE: PS50235; DE Function: Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1. Possesses both ubiquitin- specific peptidase and isopeptidase activities. Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity. Has no deubiquitinase activity against p53/TP53. Prevents MDM2-mediated degradation of MDM4. Plays a role in the G1/S cell-cycle progression in normal and cancer cells. Plays a role in the regulation of myogenic differentiation of embryonic muscle cells. Regulates the circadian clock by modulating its intrinsic circadian rhythm and its capacity to respond to external cues. Associates with clock proteins and deubiquitinates core clock component PER1 but does not affect its overall stability. Regulates the nucleocytoplasmic shuttling and nuclear retention of PER1 and its repressive role on the clock transcription factors CLOCK and ARNTL/BMAL1. {ECO:0000250|UniProtKB:O75604, ECO:0000250|UniProtKB:O88623}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0048471; GO GO:0004843; GO GO:0046872; GO GO:0007049; GO GO:0048512; GO GO:0032922; GO GO:0043153; GO GO:0045475; GO GO:0007517; GO GO:0000122; GO GO:0045931; GO GO:0016579; GO GO:0050821; GO GO:0006511; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSQLSSTLKRYTESARFTDAPFTKSSYGTYTPSSYGTNLAASFLEKEKFGFKPSPPTSYLTRPRTYGPPSILDYDRGRPL SQ LRPDVIGGGKRAESQTRGTERPSGSGLSGGSGFSYGVTTSSVSYLPVSARDQGVTLTQKKSNSQSDLARDFSSLQTSDSY SQ RLDSGNLGRSPMLARTRKELCALQGLYQAASRSEYLADYLENYGRKASAPQVPTPTPPSRAPEVLSPTYRPSGRYSLWEK SQ GKGQALVSSRSSSPGRDTMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYLRDLSHSSRAHTALMEEFA SQ KLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVIARPKSNTENLDHLPDDEKGRQM SQ WRKYLEREDSRIGDLFVGQLKSSLTCTDCGYCSTVFDPFWDLSLPITKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRC SQ RARKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTAFVNFPLRDLDLREFASENTNHAVYNLYAVSNHSGTTMGGHYT SQ AYCRSPVTGEWHTFNDSSVSPMSSSQVRTSDAYLLFYELASPPSRM //