ID Q2KJ94; PN DNA repair protein RAD51 homolog 1; GN RAD51; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250|UniProtKB:Q06609}. Cytoplasm {ECO:0000250|UniProtKB:Q06609}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q06609}. Mitochondrion matrix {ECO:0000250|UniProtKB:Q06609}. Chromosome {ECO:0000250|UniProtKB:Q06609}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q06609}. Note=Colocalizes with RAD51AP1 and RPA2 to multiple nuclear foci upon induction of DNA damage. DNA damage induces an increase in nuclear levels. Together with FIGNL1, redistributed in discrete nuclear DNA damage-induced foci after ionizing radiation (IR) or camptothecin (CPT) treatment. Accumulated at sites of DNA damage in a SPIDR-dependent manner. Recruited at sites of DNA damage in a MCM9-MCM8-dependent manner. Colocalizes with ERCC5/XPG to nuclear foci in S phase. Recruited to stalled replication forks during replication stress by the TONSL-MMS22L complex, as well as ATAD5 and WDR48 in an ATR-dependent manner. {ECO:0000250|UniProtKB:Q06609}. DR UNIPROT: Q2KJ94; DR Pfam: PF08423; DR PROSITE: PS50162; DR PROSITE: PS50163; DE Function: Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR). Binds to single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. Recruited to resolve stalled replication forks during replication stress. Part of a PALB2- scaffolded HR complex containing BRCA2 and RAD51C and which is thought to play a role in DNA repair by HR. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3. Also involved in interstrand cross- link repair. {ECO:0000250|UniProtKB:Q06609}. DE Reference Proteome: Yes; GO GO:0000785; GO GO:0005694; GO GO:0000781; GO GO:0005737; GO GO:0009897; GO GO:0000800; GO GO:0001673; GO GO:0005815; GO GO:0005759; GO GO:0000228; GO GO:0000152; GO GO:0005634; GO GO:0048471; GO GO:0016605; GO GO:0035861; GO GO:0005524; GO GO:0140664; GO GO:0003682; GO GO:0070182; GO GO:0000150; GO GO:0003690; GO GO:0042802; GO GO:0008022; GO GO:0019903; GO GO:0003697; GO GO:0017116; GO GO:0072757; GO GO:0006974; GO GO:0072711; GO GO:0071479; GO GO:0070192; GO GO:0000730; GO GO:0006268; GO GO:0000724; GO GO:0036297; GO GO:1990426; GO GO:0002769; GO GO:2000272; GO GO:0051106; GO GO:0010569; GO GO:0001932; GO GO:1990414; GO GO:0000722; GO GO:0010833; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILTEAAK SQ LVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYI SQ DTEGTFRPERLLAVAERYGLSGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA SQ RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCL SQ PEAEAMFAINADGVGDAKD //