ID Q2MHH0; PN Trafficking regulator of GLUT4 1; GN Trarg1; OS 10116; SL Nucleus Position: SL-0198; SL Comments: Cell membrane {ECO:0000250|UniProtKB:Q8C838}; Single-pass membrane protein {ECO:0000305}. Endomembrane system {ECO:0000269|PubMed:26240143}; Single-pass membrane protein {ECO:0000305}. Cytoplasm, perinuclear region {ECO:0000269|PubMed:26240143}. Note=Shifts from low-density microsome vesicles to the cell membrane upon insulin stimulation. {ECO:0000250|UniProtKB:Q8C838}. DR UNIPROT: Q2MHH0; DR Pfam: PF04505; DE Function: Regulates insulin-mediated adipose tissue glucose uptake and transport by modulation of SLC2A4 recycling. Not required for SLC2A4 membrane fusion upon an initial stimulus, but rather is necessary for proper protein recycling during prolonged insulin stimulation. {ECO:0000305|PubMed:17007998, ECO:0000305|PubMed:26240143}. DE Reference Proteome: Yes; GO GO:0030659; GO GO:0012505; GO GO:0016021; GO GO:0016020; GO GO:0048471; GO GO:0005886; GO GO:0032869; GO GO:0099638; GO GO:0051649; GO GO:0044381; GO GO:0072659; GO GO:0099500; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MANPVQPQLQDPGSTSPLDLPEMEKLLTKVENKDDQALNLSKSLSGALDLEQNGHSLPFKVISEGHRQPSLSGSPSRASS SQ RRASSVVTTSYAQDQEAPKDYLVLAIASCFCPVWPLNLIPLIFSIMSRSSVQQGDLDGARRLGRLARLLSITFIILGIVI SQ IIVAVTVNFTVPK //