ID Q2NKS0; PN Leukotriene C4 synthase; GN LTC4S; OS 9913; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Nucleus outer membrane {ECO:0000250|UniProtKB:Q16873}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q16873}. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q16873}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q16873}. Nucleus membrane {ECO:0000250|UniProtKB:Q16873}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q16873}. DR UNIPROT: Q2NKS0; DR Pfam: PF01124; DE Function: Catalyzes the conjugation of leukotriene A4 with reduced glutathione (GSH) to form leukotriene C4 with high specificity. Can also catalyzes the transfer of a glutathionyl group from glutathione (GSH) to 13(S),14(S)-epoxy-docosahexaenoic acid to form maresin conjugate in tissue regeneration 1 (MCTR1), a bioactive lipid mediator that possess potent anti-inflammatory and proresolving actions. {ECO:0000250|UniProtKB:Q16873}. DE Reference Proteome: Yes; GO GO:0005783; GO GO:0005789; GO GO:0016021; GO GO:0005635; GO GO:0031965; GO GO:0005640; GO GO:0008047; GO GO:0004602; GO GO:0004364; GO GO:0042802; GO GO:0004464; GO GO:0008289; GO GO:0019370; GO GO:0006691; GO GO:0042759; TP Membrane Topology: Transmembrane; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q16873}; SQ MKDEVALLASVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERIYRAQVNCSEYFPLFLAMLWVAGIFFHEGAAA SQ LCGLVYLFARLRYFQGYARSAQQRLAPLYASARALWLLVALAALGLLAHFLPAELRAALLGQLRKLLLRS //