ID Q2PFW6; PN Gamma-synuclein; GN SNCG; OS 9541; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle (By similarity). {ECO:0000250}. DR UNIPROT: Q2PFW6; DR Pfam: PF01387; DE Function: Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases (By similarity). May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005815; GO GO:0048471; GO GO:0005819; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVHSVTSVAEKTKEQANAVSEAVVSSVNTVAAK SQ TVEEAENIAVTSGVVRKEDLKPSAPQQEGEAAKEKEEVAEEAQSGGD //