ID Q2PKF4; PN Guanine nucleotide-binding protein G(q) subunit alpha; GN GNAQ; OS 9823; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cell membrane {ECO:0000250|UniProtKB:P50148}; Lipid-anchor {ECO:0000250|UniProtKB:P50148}. Golgi apparatus {ECO:0000250|UniProtKB:P50148}. Nucleus {ECO:0000250|UniProtKB:P21279}. Nucleus membrane {ECO:0000250|UniProtKB:P21279}. Note=Colocalizes with the adrenergic receptors, ADREN1A and ADREN1B, at the nuclear membrane of cardiac myocytes. {ECO:0000250|UniProtKB:P21279}. DR UNIPROT: Q2PKF4; DR Pfam: PF00503; DR PROSITE: PS51882; DE Function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Required for platelet activation. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells (in vitro) (By similarity). Transduces FFAR4 signaling in response to long- chain fatty acids (LCFAs) (By similarity). Together with GNA11, required for heart development (By similarity). {ECO:0000250|UniProtKB:P21279, ECO:0000250|UniProtKB:P50148}. DE Reference Proteome: Yes; GO GO:0005794; GO GO:0005834; GO GO:0016020; GO GO:0031965; GO GO:0001750; GO GO:0045202; GO GO:0001664; GO GO:0031683; GO GO:0005525; GO GO:0005096; GO GO:0003924; GO GO:0046872; GO GO:0001508; GO GO:0007189; GO GO:0007188; GO GO:0009649; GO GO:0007213; GO GO:0007215; GO GO:0006469; GO GO:0007603; GO GO:0050821; GO GO:0060828; GO GO:0010543; TP Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:P21279}; SQ MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVY SQ QNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYY SQ LNDLDRVADPAYLPTQQDVLRVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV SQ ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDS SQ DKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV //