ID Q2V8Y7; PN Neuronal calcium sensor 1; GN NCS1; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Golgi apparatus {ECO:0000250|UniProtKB:P62166}. Postsynaptic density {ECO:0000250|UniProtKB:P62166}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:P62166}. Cytoplasm {ECO:0000250|UniProtKB:P62168}. Cell membrane {ECO:0000250|UniProtKB:P62166}; Peripheral membrane protein {ECO:0000250|UniProtKB:P62166}. Membrane {ECO:0000250|UniProtKB:P62168}; Lipid-anchor {ECO:0000250|UniProtKB:P62166}. Note=Associated with Golgi stacks. Post-synaptic densities of dendrites, and in the pre-synaptic nerve terminal at neuromuscular junctions. {ECO:0000250|UniProtKB:P62166}. DR UNIPROT: Q2V8Y7; DR Pfam: PF00036; DR Pfam: PF13499; DR PROSITE: PS00018; DR PROSITE: PS50222; DE Function: Neuronal calcium sensor, regulator of G protein-coupled receptor phosphorylation in a calcium dependent manner. Directly regulates GRK1 (RHOK), but not GRK2 to GRK5. Can substitute for calmodulin (By similarity). Stimulates PI4KB kinase activity (By similarity). Involved in long-term synaptic plasticity through its interaction with PICK1 (By similarity). May also play a role in neuron differentiation through inhibition of the activity of N-type voltage- gated calcium channel (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0070161; GO GO:0005794; GO GO:0048471; GO GO:0005886; GO GO:0014069; GO GO:0005509; GO GO:0008048; GO GO:0005245; GO GO:0010975; TP Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:P62166}; SQ MGKSNSKLKPEVVEELTRKTYFTEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRI SQ EFSEFIQALSVTSRGTLDEKLRWASKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKRVDRIFAMMDKNA SQ DGKLTLQEFQEGTKADPSIVQALSLYDGLV //