ID Q3T013; PN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; GN BNIP3L; OS 9913; SL Nucleus Position: SL-0178; SL Comments: Nucleus envelope {ECO:0000250}. Endoplasmic reticulum {ECO:0000250}. Mitochondrion outer membrane {ECO:0000250}. Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Note=Colocalizes with SPATA18 at the mitochondrion outer membrane. {ECO:0000250}. DR UNIPROT: Q3T013; DR UNIPROT: A5D9C5; DR Pfam: PF06553; DE Function: Induces apoptosis. Interacts with viral and cellular anti- apoptosis proteins. Can overcome the suppressors BCL-2 and BCL-XL, although high levels of BCL-XL expression will inhibit apoptosis. Inhibits apoptosis induced by BNIP3. Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). May function as a tumor suppressor (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005783; GO GO:0016021; GO GO:0005741; GO GO:0005739; GO GO:0005635; GO GO:0005634; GO GO:0042802; GO GO:0051607; GO GO:0097345; GO GO:0035694; GO GO:0043065; GO GO:0043067; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MSSHLVEQPPPPHNNNNNCEEGEQSLPPPAGLNSSWVELPMNSSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQH SQ ESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSKDHSSQSEEEVAEGEKEVDALKKSVDWVSDWSSRPENIPPKEFHFRH SQ PKRSVSLSMRKSGAMKKGGIFSAEFLKVFIPSLFLSHVLALGLGIYIGKRLSTPSASTY //