ID Q3TUD9; PN Transmembrane protein 18; GN Tmem18; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:Q96B42}. Nucleus membrane {ECO:0000250|UniProtKB:Q96B42}; Multi-pass membrane protein {ECO:0000255}. DR UNIPROT: Q3TUD9; DR UNIPROT: Q8CID7; DR Pfam: PF14770; DE Function: Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor cells (NPC) (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0016021; GO GO:0031965; GO GO:0003677; GO GO:0016477; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MSSAYSVRSFPVSIPAVIMETDWTEPWLLGLLAFHLLCLLLTCFSSQRYKLQIGHFLCLVVLVYSAEYINEVAAVNWRLF SQ SKYQYFDSRGMFISLVFSAPLLFNAMLIVIMWVRKTLTVMTDLKTLQEERKERRRRRKEE //