ID Q4KLJ8; PN Phosducin-like protein 3; GN Pdcl3; OS 10116; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm {ECO:0000250|UniProtKB:Q9H2J4}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9H2J4}. Endoplasmic reticulum {ECO:0000250|UniProtKB:Q9H2J4}. DR UNIPROT: Q4KLJ8; DR Pfam: PF02114; DE Function: Acts as a chaperone for the angiogenic VEGF receptor KDR/VEGFR2, increasing its abundance by inhibiting its ubiquitination and degradation (By similarity). Inhibits the folding activity of the chaperonin-containing T-complex (CCT) which leads to inhibition of cytoskeletal actin folding (By similarity). Acts as a chaperone during heat shock alongside HSP90 and HSP40/70 chaperone complexes (PubMed:27496612). Modulates the activation of caspases during apoptosis (By similarity). {ECO:0000250|UniProtKB:Q9H2J4, ECO:0000269|PubMed:27496612}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005783; GO GO:0048471; GO GO:0097356; GO GO:0032991; GO GO:0044183; GO GO:0043184; GO GO:0030036; GO GO:0001525; GO GO:0006915; GO GO:0034605; GO GO:0061077; GO GO:1903645; GO GO:2000059; GO GO:0045766; GO GO:0001938; GO GO:0010628; GO GO:0006457; GO GO:0050821; GO GO:0050730; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MQDPNADTEWNDILRKKGILPPKESLKELEEEEEGKEEQRLQQSVVKTYEDMTLEELQENEDEFSEEDERAIEMYRQQRL SQ AEWKATQLRNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYP SQ DRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTELEENPKKAIKDVLLSSVRDPVPMRRDSDSEDD //