ID Q5E9V1; PN DCN1-like protein 3; GN DCUN1D3; OS 9913; SL Nucleus Position: SL-0198; SL Comments: Cell membrane {ECO:0000250|UniProtKB:Q8IWE4}. Cytoplasm {ECO:0000250|UniProtKB:Q8IWE4}. Nucleus {ECO:0000250|UniProtKB:Q8IWE4}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q8IWE4}. Note=After UVC treatment, the protein enters to the nucleus gradually. Cell membrane localization is essential for CUL3 neddylation. {ECO:0000250|UniProtKB:Q8IWE4}. DR UNIPROT: Q5E9V1; DR Pfam: PF03556; DR PROSITE: PS51229; DE Function: Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and may play a role in the cell cycle progression by regulating the SCF ubiquitin E3 ligase complex, after UV damage. At the cell membrane, can promote and as well inhibit cullins neddylation. {ECO:0000250|UniProtKB:Q8IWE4}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:0005886; GO GO:0000151; GO GO:0097602; GO GO:0031624; GO GO:0032182; GO GO:0030308; GO GO:2000134; GO GO:2000435; GO GO:0043065; GO GO:2000436; GO GO:0051443; GO GO:0045116; GO GO:0010564; GO GO:2000434; GO GO:0010332; GO GO:0010225; TP Membrane Topology: Lipid-Anchored; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q8IWE4,}; SQ MGQCVTKCKNPSSTLGSKNGDRDPSSKSHGRRSASHREEQLPTCGKPGGDILVNGTKKAEAAPEACQLPTSSGDAGREPK SQ SNAEESSLQRLEELFRRYKDEREDAILEEGMERFCNDLCVDPTEFRVLLLAWKFQAATMCKFTRKEFFDGCKAISADSID SQ GICARFPSLLTEAKQEDKFKDLYRFTFQFGLDSEEGQRSLHREIAIALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISR SQ DTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKREGEGRGALSSGPEGLCPEEQT //