ID Q5M844; PN Nesprin-4; GN Syne4; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Nucleus outer membrane {ECO:0000250}; Single-pass type IV membrane protein {ECO:0000250}. Note=Localization at the nucleus outer membrane location requires the presence of SUN1. {ECO:0000250}. DR UNIPROT: Q5M844; DR Pfam: PF10541; DR PROSITE: PS51049; DE Function: As a component of the LINC (LInker of Nucleoskeleton and Cytoskeleton) complex, involved in the connection between the nuclear lamina and the cytoskeleton. The nucleocytoplasmic interactions established by the LINC complex play an important role in the transmission of mechanical forces across the nuclear envelope and in nuclear movement and positioning. Behaves as a kinesin cargo, providing a functional binding site for kinesin-1 at the nuclear envelope. Hence may contribute to the establishment of secretory epithelial morphology, by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0031309; GO GO:0034993; GO GO:0045198; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255|PROSITE-ProRule:PRU00385}; SQ MAQFPLLGHGFPPEPVNHPLGGPRGLDVAGPTICPAPEEEPSRPEQVQASLDAPEHFMDEPKSTESATSPSKLPLASSHE SQ HQDGGKPCEALQAELQGAAERVDALLVFGEGLAERSEPRAWTSLEQVLRALGTHRDTIFQRLWQLQAQLISYSLVLEKAN SQ LLDQDLEVEGDSDGPAAGGVWGPWAPSIFPTPAELEWDPAGDVGGLGPSGQKISRIPGAPCELCGYRGSQSSGQGFEDLL SQ SLGLGHRKHLAAHHRRRLQKPQDKKRQGPPSLPDAMLEVDRGVPAPASRRPLTFLLLLLFLLLVGATLLLPLSGVPCCSH SQ TRLARTPYLVLSYVNGLPPI //