ID Q5PXE3; PN Sigma non-opioid intracellular receptor 1; GN SIGMAR1; OS 36723; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Comments: Nucleus inner membrane {ECO:0000250|UniProtKB:Q99720}. Nucleus outer membrane {ECO:0000250|UniProtKB:Q99720}. Nucleus envelope {ECO:0000250|UniProtKB:Q99720}. Cytoplasmic vesicle {ECO:0000250|UniProtKB:Q99720}. Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q99720}. Membrane {ECO:0000250|UniProtKB:Q99720}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q99720}. Lipid droplet {ECO:0000250|UniProtKB:O55242}. Cell junction {ECO:0000250|UniProtKB:Q99720}. Cell membrane {ECO:0000250|UniProtKB:Q99720}. Cell projection, growth cone {ECO:0000250|UniProtKB:Q99720}. Postsynaptic density membrane {ECO:0000250|UniProtKB:Q99720}. Note=During interphase, detected at the inner and outer nuclear membrane and the endoplasmic reticulum. Detected on cytoplasmic vesicles during mitosis. Targeted to lipid droplets, cholesterol and galactosylceramide-enriched domains of the endoplasmic reticulum (By similarity). Enriched at cell-cell communication regions, growth cone and postsynaptic structures. Localization is modulated by ligand-binding. In motor neurons it is enriched at cholinergic postsynaptic densities (By similarity). {ECO:0000250|UniProtKB:O55242, ECO:0000250|UniProtKB:Q99720}. DR UNIPROT: Q5PXE3; DR Pfam: PF04622; DE Function: Functions in lipid transport from the endoplasmic reticulum and is involved in a wide array of cellular functions probably through regulation of the biogenesis of lipid microdomains at the plasma membrane. Involved in the regulation of different receptors it plays a role in BDNF signaling and EGF signaling. Also regulates ion channels like the potassium channel and could modulate neurotransmitter release. Plays a role in calcium signaling through modulation together with ANK2 of the ITP3R-dependent calcium efflux at the endoplasmic reticulum. Plays a role in several other cell functions including proliferation, survival and death. Originally identified for its ability to bind various psychoactive drugs it is involved in learning processes, memory and mood alteration (By similarity). Necessary for proper mitochondrial axonal transport in motor neurons, in particular the retrograde movement of mitochondria. Plays a role in protecting cells against oxidative stress-induced cell death via its interaction with RNF112 (By similarity). {ECO:0000250|UniProtKB:O55242, ECO:0000250|UniProtKB:Q99720}. DE Reference Proteome: No; GO GO:0070161; GO GO:0031410; GO GO:0005789; GO GO:0030426; GO GO:0016021; GO GO:0005811; GO GO:0005637; GO GO:0005640; GO GO:0014069; GO GO:0098839; GO GO:0036474; GO GO:0006869; GO GO:0043523; TP Membrane Topology: Transmembrane; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q99720}; SQ MQWALGRRWVWAALLLAAAAVLTQVVWLWLGTQSFVFQHEEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQ SQ WVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEAT SQ AVEWGPNTWMVEYGRGVIPSTLAFALADTIFSTQDFLTLFYTLRAYARGLRLEFTTYLFGQDS //