ID Q5R8G4; PN Nuclear transport factor 2; GN NUTF2; OS 9601; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Nucleus Position: SL-0183; SL Nucleus Position: SL-0185; SL Comments: Cytoplasm, cytosol {ECO:0000250|UniProtKB:P61970}. Nucleus outer membrane {ECO:0000250|UniProtKB:P61972}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:P61972}. Nucleus inner membrane {ECO:0000250|UniProtKB:P61972}. Nucleus, nucleoplasm {ECO:0000250|UniProtKB:P61970}. Note=At steady state it is essentially nucleoplasmic, enriched in nucleoplasmic foci. {ECO:0000250|UniProtKB:P61970}. DR UNIPROT: Q5R8G4; DR UNIPROT: H2NR93; DR Pfam: PF02136; DR PROSITE: PS50177; DE Function: Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import. {ECO:0000250|UniProtKB:P61970}. DE Reference Proteome: Yes; GO GO:0005829; GO GO:0005637; GO GO:0031965; GO GO:0005640; GO GO:0005643; GO GO:0005654; GO GO:0042802; GO GO:0031267; GO GO:0017056; GO GO:0051028; GO GO:0006611; GO GO:0006606; GO GO:0090204; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC SQ IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG //