ID Q5R8I2; PN RNA transcription, translation and transport factor protein; GN RTRAF; OS 9601; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q9Y224}. Note=May localize at the centrosome during mitosis. Shuttles between the cytosol and the nucleus: enters into the nucleus in case of active transcription while it accumulates in cytosol when transcription level is low. {ECO:0000250|UniProtKB:Q9Y224}. DR UNIPROT: Q5R8I2; DR Pfam: PF10036; DE Function: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex and is required for tRNA ligation. May be required for RNA transport. {ECO:0000250|UniProtKB:Q9Y224}. DE Reference Proteome: Yes; GO GO:0005813; GO GO:0005737; GO GO:0005829; GO GO:0072686; GO GO:0005654; GO GO:0005634; GO GO:0048471; GO GO:0072669; GO GO:0042802; GO GO:0003723; GO GO:0000993; GO GO:0006469; GO GO:0045944; GO GO:0006388; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAI SQ DWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILV SQ QERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLG SQ KVGR //