ID Q5RCU3; PN N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D; GN NAPEPLD; OS 9601; SL Nucleus Position: SL-0178; SL Comments: Golgi apparatus membrane {ECO:0000250|UniProtKB:Q6IQ20}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q6IQ20}. Early endosome membrane {ECO:0000250|UniProtKB:Q6IQ20}; Peripheral membrane protein {ECO:0000250|UniProtKB:Q6IQ20}. Nucleus envelope {ECO:0000250|UniProtKB:Q6IQ20}. Nucleus, nucleoplasm {ECO:0000250|UniProtKB:Q6IQ20}. Note=Localized in the proximity of the cellular membranes likely through interaction with membrane phospholipids. {ECO:0000250|UniProtKB:Q6IQ20}. DR UNIPROT: Q5RCU3; DR Pfam: PF12706; DE Function: D-type phospholipase that hydrolyzes N-acyl- phosphatidylethanolamines (NAPEs) to produce bioactive N- acylethanolamines/fatty acid ethanolamides (NAEs/FAEs) and phosphatidic acid (By similarity). Cleaves the terminal phosphodiester bond of diacyl- and alkenylacyl-NAPEs, primarily playing a role in the generation of long-chain saturated and monounsaturated NAEs in the brain (By similarity). May control NAPE homeostasis in dopaminergic neuron membranes and regulate neuron survival, partly through RAC1 activation (By similarity). As a regulator of lipid metabolism in the adipose tissue, mediates the crosstalk between adipocytes, gut microbiota and immune cells to control body temperature and weight. In particular, regulates energy homeostasis by promoting cold-induced brown or beige adipocyte differentiation program to generate heat from fatty acids and glucose. Has limited D-type phospholipase activity toward N-acyl lyso-NAPEs (By similarity). {ECO:0000250|UniProtKB:Q6IQ20, ECO:0000250|UniProtKB:Q8BH82}. DE Reference Proteome: Yes; GO GO:0005769; GO GO:0031901; GO GO:0005794; GO GO:0000139; GO GO:0005635; GO GO:0005654; GO GO:0102200; GO GO:0070290; GO GO:0008270; GO GO:0048874; GO GO:0070292; GO GO:0009395; GO GO:0090336; GO GO:0050729; GO GO:0001659; TP Membrane Topology: Peripheral; Source: UniProt - By Similarity {ECO:0000250|UniProtKB:Q6IQ20}; SQ MDENESNQSLMTSSQYPKEAVRKRQNSARNSGGSDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWPTWKNHSIPHV SQ LRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVRETGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYM SQ GPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPG SQ HDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRRFMKYQ SQ HVDPEEAVRIHIDVQTKKSMAIHWGTFALANEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNTDDENF //