ID Q5RJR8; PN Leucine-rich repeat-containing protein 59, N-terminally processed; GN Lrrc59; OS 10116; SL Nucleus Position: SL-0178; SL Comments: Microsome membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Nucleus envelope {ECO:0000250}. Note=Localization in the nuclear envelope depends upon the nuclear import machinery, including KPNB1. {ECO:0000250}. DR UNIPROT: Q5RJR8; DR UNIPROT: Q63742; DR Pfam: PF13855; DR PROSITE: PS51450; DE Function: Required for nuclear import of FGF1, but not that of FGF2. Might regulate nuclear import of exogenous FGF1 by facilitating interaction with the nuclear import machinery and by transporting cytosolic FGF1 to, and possibly through, the nuclear pores (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: P11362; IntAct: EBI-22243924; Score: 0.35 GO GO:0005789; GO GO:0016021; GO GO:0042645; GO GO:0005635; GO GO:0046579; GO GO:0007165; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MTKTGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATVLDLSCNKLSTLPSDFCGLTHLVKLDLSKNKLQQLPAD SQ FGRLVNLQHLDLLNNRLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQ SQ RRLEVEREAEKKREAKQQAKEAKERELRKREKAEEKERRRKEYDAQKASKREQEKKPKKETNQAPKSKSGSRPRKPPPRK SQ HNRSWAVLKGLLLLLLLCVAGGLVVCRVTGLQQQPLCTSVNAIYDNAVQGLRHHEILQWVLQTDSQQ //