ID Q5U395; PN CTD nuclear envelope phosphatase 1A; GN ctdnep1a; OS 7955; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. Nucleus membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. DR UNIPROT: Q5U395; DR Pfam: PF03031; DR PROSITE: PS50969; DE Function: Serine/threonine protein phosphatase that may dephosphorylate and activate lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005789; GO GO:0016021; GO GO:0071595; GO GO:0005635; GO GO:0031965; GO GO:0017018; GO GO:0004721; GO GO:0004722; GO GO:0006998; GO GO:0010867; GO GO:0006470; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MLKTRQCLLGIRTFLGVTSRIWSFFLYILRKHLRTIIQYQTVRYDILPLSPISRNRLNAVKRKILVLDLDETLIHSHHDG SQ VLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNNRGILKRRYYRQ SQ HCTLDLGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTSDVRSVLSRNLH SQ QHRLW //