ID Q5U3Y7; PN Sigma intracellular receptor 2; GN Tmem97; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0182; SL Comments: Nucleus membrane {ECO:0000250|UniProtKB:Q5BJF2}; Multi-pass membrane protein {ECO:0000255}. Rough endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q5BJF2}; Multi-pass membrane protein {ECO:0000255}. Note=Localized at cell membrane and in lysosomes in sterol-depleted cells when expression of endogenous TMEM97 is stimulated. {ECO:0000250|UniProtKB:Q5BJF2}. DR UNIPROT: Q5U3Y7; DR PROSITE: PS51751; DE Function: Intracellular orphan receptor that binds numerous drugs and which is highly expressed in various proliferating cells. Corresponds to the sigma-2 receptor, which is thought to play important role in regulating cell survival, morphology and differentiation. May play a role as a regulator of cellular cholesterol homeostasis. May function as sterol isomerase. May alter the activity of some cytochrome P450 proteins. {ECO:0000250|UniProtKB:Q5BJF2}. DE Reference Proteome: Yes; GO GO:0005783; GO GO:0016021; GO GO:0005764; GO GO:0031965; GO GO:0005886; GO GO:0005791; GO GO:0030867; GO GO:0042632; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MGAVTARRCVEWLLGLYFVSHIPITMFIDLQALLPPELYPQEFSNLLRWYSKEFKDPLMQEPPVWFKSFLFCELVFQLPF SQ FPIAAYAFFKGSCRWIRIPAIIYAVHTITTLIPILYTILFEDFSKAIAFKGQRPENFRERLTLVGVYAPYLIIPLILLLF SQ MLRNPYYKFEEKRKKK //