ID Q5XIP9; PN Transmembrane protein 43; GN Tmem43; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Endoplasmic reticulum membrane {ECO:0000250|UniProtKB:Q9BTV4}. Nucleus inner membrane {ECO:0000250|UniProtKB:Q9BTV4}; Multi-pass membrane protein {ECO:0000250|UniProtKB:Q9BTV4}. Note=Retained in the inner nuclear membrane through interaction with EMD and A- and B-lamins. The N- and C-termini are oriented towards the nucleoplasm. The majority of the hydrophilic domain resides in the endoplasmic reticulum lumen (By similarity). {ECO:0000250}. DR UNIPROT: Q5XIP9; DR Pfam: PF07787; DE Function: May have an important role in maintaining nuclear envelope structure by organizing protein complexes at the inner nuclear membrane. Required for retaining emerin at the inner nuclear membrane (By similarity). Plays a role in the modulation of innate immune signaling through the cGAS-STING pathway by interacting with RNF26 (By similarity). In addition, functions as a critical signaling component in mediating NF-kappa-B activation by acting downstream of EGFR and upstream of CARD10 (By similarity). {ECO:0000250|UniProtKB:Q9BTV4}. DE Reference Proteome: Yes; DE Interaction: P19357; IntAct: EBI-921030; Score: 0.35 DE Interaction: Q969Q1; IntAct: EBI-21997483; Score: 0.35 GO GO:0005788; GO GO:0005789; GO GO:0005639; GO GO:0005637; GO GO:0042802; GO GO:0043621; GO GO:0045087; GO GO:0071763; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MAANYSSTGSRKEHVKVTSDPQPGFLERLSETSGGMFVGLVTFLLSFYLIFTNEGRALKTANLLAEGLSLVVSPDSIHSV SQ APENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEMYQWVETEESNEYTEDGQVKKETKYSYNTEWRSEIVSSKN SQ FDREIGHKNPSAMAVESFTATAPFVQIGRFFLSAGLIDKIDNFKPLSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVR SQ VSFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQKSNSMKTWGLRAAGWMAMF SQ MGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTLLTVAAGWLFYRPLWAALLGCLALVPIIIARTRVPTKKLE //