ID Q5XIU9; PN Membrane-associated progesterone receptor component 2; GN Pgrmc2; OS 10116; SL Nucleus Position: SL-0178; SL Comments: Membrane {ECO:0000250|UniProtKB:Q80UU9}; Single- pass membrane protein {ECO:0000250|UniProtKB:Q80UU9}. Nucleus envelope {ECO:0000250|UniProtKB:O15173}. Endoplasmic reticulum {ECO:0000250|UniProtKB:O15173}. DR UNIPROT: Q5XIU9; DR Pfam: PF00173; DE Function: Required for the maintenance of uterine histoarchitecture and normal female reproductive lifespan. May serve as a universal non- classical progesterone receptor in the uterus. Intracellular heme chaperone required for delivery of labile, or signaling heme, to the nucleus. Plays a role in adipocyte function and systemic glucose homeostasis. In brown fat, which has a high demand for heme, delivery of labile heme in the nucleus regulates the activity of heme-responsive transcriptional repressors such as NR1D1 and BACH1. {ECO:0000250|UniProtKB:Q80UU9}. DE Reference Proteome: Yes; DE Interaction: P19357; IntAct: EBI-921030; Score: 0.35 GO GO:0012505; GO GO:0005783; GO GO:0016021; GO GO:0016020; GO GO:0005635; GO GO:0020037; GO GO:0015232; GO GO:0005496; GO GO:0060612; GO GO:0015886; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MAAGDGDVKLSTLGSGGERGGDGSPGGAGATAARSSWVAALLATGGEMLLNVALVALVLLGAYRLWVRWGRRGLCSGPGA SQ GEESPAATLPRMKKRDFSLEQLRQYDGARTPRILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALR SQ DEYDDLSDLNAVQMESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEEDTKDHSKQD //