ID Q61029; PN Lamina-associated polypeptide 2, isoforms beta/delta/epsilon/gamma; GN Tmpo; OS 10090; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Nucleus inner membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Chromosome {ECO:0000250}. Note=Tightly associated with the nuclear lamina. {ECO:0000250}. DR UNIPROT: Q61029; DR UNIPROT: Q3UCI5; DR UNIPROT: Q61030; DR UNIPROT: Q61031; DR UNIPROT: Q61032; DR Pfam: PF03020; DR Pfam: PF08198; DR PROSITE: PS50954; DR PROSITE: PS50955; DE Function: May help direct the assembly of the nuclear lamina and thereby help maintain the structural organization of the nuclear envelope. Possible receptor for attachment of lamin filaments to the inner nuclear membrane. May be involved in the control of initiation of DNA replication through its interaction with NAKAP95 (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; DE Interaction: Q64321; IntAct: EBI-6172093; Score: 0.50 DE Interaction: O88895; IntAct: EBI-6172144; Score: 0.35 DE Interaction: O88609; IntAct: EBI-13951426; Score: 0.35 DE Interaction: P70326; IntAct: EBI-16360068; Score: 0.35 GO GO:0000785; GO GO:0016021; GO GO:0005635; GO GO:0005637; GO GO:0031965; GO GO:0005634; GO GO:0003677; GO GO:0006355; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSKGPPDFSSDEEREPTPVLGSG SQ ASVGRGRGAVGRKATKKTDKPRLEDKDDLDVTELSNEELLDQLVRYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTP SQ LPTVSSSAENTRQNGSNDSDRYSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRTEHNQSYSQAGVTETEWTSGSSTGG SQ PLQALTRESTRGSRRTPRKRVETSQHFRIDGAVISESTPIAETIKASSNESLVANRLTGNFKHASSILPITEFSDITRRT SQ PKKPLTRAEVGEKTEERRVDRDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYAPLADVK SQ SEKTKKRRSVPMWIKMLLFALVAVFLFLVYQAMETNQGNPFTNFLQDTKISN //