ID Q63327; PN Myelin-associated oligodendrocyte basic protein; GN Mobp; OS 10116; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000269|PubMed:10537049, ECO:0000269|PubMed:8551331}. Note=Present in the major dense line of CNS myelin. Isoform 5 may be differentially localized in the oligodendrocytes or perinuclear region. Isoform 2, 4, 5 and 6 are highly enriched in myelin. Isoform 1 and 3 are not enriched in mylein. DR UNIPROT: Q63327; DR UNIPROT: Q63328; DR UNIPROT: Q63343; DR UNIPROT: Q63519; DR UNIPROT: Q64266; DR UNIPROT: Q9QZV5; DR Pfam: PF02318; DE Function: May play a role in compacting or stabilizing the myelin sheath, possibly by binding the negatively charged acidic phospholipids of the cytoplasmic membrane. {ECO:0000269|PubMed:7989345}. DE Reference Proteome: Yes; GO GO:0030864; GO GO:0005739; GO GO:0043209; GO GO:0048471; GO GO:0003779; GO GO:0017022; GO GO:0019911; GO GO:0032289; GO GO:0007399; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSQKVAKEGPRLSKNQKFSEHFSIHCCPPFTFLNSKREIVDRKYSICKSGCFYQKKEEDWICCACQKTSRRATSPQKPKH SQ QPAASPVVVRAPPAKPKSPPRPAKPRSPPIPAKPRSPSRTERQPRPRPEVRPPPAKQKPPQKSKQPARSSPLRGPGTSRG SQ GSPTRAPRFW //