ID Q63ZS0; PN RNA transcription, translation and transport factor protein; GN rtraf; OS 8355; SL Nucleus Position: SL-0198; SL Comments: Nucleus {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q9Y224}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:Q9Y224}. Note=Shuttles between the cytosol and the nucleus. {ECO:0000250|UniProtKB:Q9Y224}. DR UNIPROT: Q63ZS0; DR Pfam: PF10036; DE Function: RNA-binding protein involved in modulation of mRNA transcription by Polymerase II. Component of the tRNA-splicing ligase complex. {ECO:0000250|UniProtKB:Q9Y224}. DE Reference Proteome: Yes; DE Interaction: Q6P5F9; IntAct: EBI-11606853; Score: 0.35 GO GO:0005813; GO GO:0005737; GO GO:0005829; GO GO:0072686; GO GO:0005634; GO GO:0048471; GO GO:0072669; GO GO:0003723; GO GO:0000993; GO GO:0006469; GO GO:0045944; GO GO:0006388; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFRRKLQALDYHNPAGFNFKDETEFRNFLVWLEDQKIRHYKIEERGNLRNIHSSEWPAQYEKYLNDVNCPFKVQERQESI SQ DWLLGLAVRLEYGDNAAKYQNAKPYNSDVSKSAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLMMLKAIRILVQERL SQ SQEAVAKSNSAKEGLPVALDKHILGFDTGDAVLNDAARILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR //