ID  Q66KV4;
PN  Barrier-to-autointegration factor B;
GN  banf1;
OS  8355;
SL  Nucleus Position: SL-0178;
SL  Comments: Nucleus {ECO:0000269|PubMed:19167377}. Chromosome {ECO:0000250|UniProtKB:O75531}. Nucleus envelope {ECO:0000269|PubMed:19167377}. Cytoplasm {ECO:0000250|UniProtKB:O75531}. Note=Significantly enriched at the nuclear inner membrane, diffusely throughout the nucleus during interphase and concentrated at the chromosomes during the M-phase. {ECO:0000250|UniProtKB:O75531}.
DR  UNIPROT: Q66KV4;
DR  Pfam: PF02961;
DE  Function: Non-specific DNA-binding protein that plays key roles in mitotic nuclear reassembly, chromatin organization, DNA damage response, gene expression and intrinsic immunity against foreign DNA. Contains two non-specific double-stranded DNA (dsDNA)-binding sites which promote DNA cross-bridging. Plays a key role in nuclear membrane reformation at the end of mitosis by driving formation of a single nucleus in a spindle-independent manner. Transiently cross-bridges anaphase chromosomes via its ability to bridge distant DNA sites, leading to the formation of a dense chromatin network at the chromosome ensemble surface that limits membranes to the surface. Also acts as a negative regulator of innate immune activation by restricting CGAS activity toward self-DNA upon acute loss of nuclear membrane integrity. Outcompetes CGAS for DNA-binding, thereby preventing CGAS activation and subsequent damaging autoinflammatory responses. Also involved in DNA damage response; acts by inhibiting the ADP-ribosyltransferase activity of PARP1. Involved in the recognition of exogenous dsDNA in the cytosol: associates with exogenous dsDNA immediately after its appearance in the cytosol at endosome breakdown and is required to avoid autophagy. {ECO:0000250|UniProtKB:O75531}.
DE  Reference Proteome: Yes;
DE  Interaction: B9X187; IntAct: EBI-12596342; Score: 0.46
DE  Interaction: Q7ZTB4; IntAct: EBI-12596356; Score: 0.40
GO  GO:0000785;
GO  GO:0005635;
GO  GO:0003677;
GO  GO:0010836;
GO  GO:0006979;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MSSTSQKHRDFVAEPMGEKSVQCLAGIGDTLGRRLEEKGFDKAYVVLGQFLVLKKDEELFKEWLKDACSANAKQSRDCYG
SQ  CLKEWCDAFL
//