ID  Q67616;
PN  Protein V2;
GN  V2;
OS  221538;
SL  Nucleus Position: SL-0382;
SL  Comments: Host cytoplasm, host perinuclear region {ECO:0000250}. Note=Accumulates in inclusion bodies in the cell periphery. May interact with the ER network from the perinuclear region out to the cell periphery (By similarity). {ECO:0000250}.
DR  UNIPROT: Q67616;
DR  Pfam: PF01524;
DR  Pfam: PF03716;
DE  Function: Through its interaction with host SGS3, acts as a suppressor of RNA-mediated gene silencing, also known as post-transcriptional gene silencing (PTGS), a mechanism of plant viral defense that limits the accumulation of viral RNAs. {ECO:0000250}.
DE  Reference Proteome: No;
GO  GO:0044220;
GO  GO:0019048;
GO  GO:0060967;
TP  Membrane Topology: Unknown; Source: UniProt - Sequence Analysis;
SQ  MWDPLLNEFPDSVHGLRCMLAIKYLQLVEETYEPNTLGHDLIRDLISVIRARDYAEANRRYTNVKPALEVSSKTELRQPV
SQ  YQPCCCPHCPRHQASIMDLQAHVSKAADVQNVQKP
//