ID Q6AYM7; PN Membrane-anchored junction protein; GN Majin; OS 10116; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0179; SL Nucleus Position: SL-0182; SL Comments: Nucleus inner membrane {ECO:0000250|UniProtKB:Q9D992}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q9D992}. Chromosome, telomere {ECO:0000250|UniProtKB:Q9D992}. Note=In leptotene spermatocytes, localizes to telomeres that localize to the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D992}. DR UNIPROT: Q6AYM7; DR Pfam: PF15077; DE Function: Meiosis-specific telomere-associated protein involved in meiotic telomere attachment to the nucleus inner membrane, a crucial step for homologous pairing and synapsis. Component of the MAJIN-TERB1- TERB2 complex, which promotes telomere cap exchange by mediating attachment of telomeric DNA to the inner nuclear membrane and replacement of the protective cap of telomeric chromosomes: in early meiosis, the MAJIN-TERB1-TERB2 complex associates with telomeric DNA and the shelterin/telosome complex. During prophase, the complex matures and promotes release of the shelterin/telosome complex from telomeric DNA. In the complex, MAJIN acts as the anchoring subunit to the nucleus inner membrane. MAJIN shows DNA-binding activity, possibly for the stabilization of telomere attachment on the nucleus inner membrane. {ECO:0000250|UniProtKB:Q9D992}. DE Reference Proteome: Yes; GO GO:0000781; GO GO:0005639; GO GO:0003677; GO GO:0007129; GO GO:0070197; GO GO:0045141; TP Membrane Topology: Transmembrane; Source: UniProt - Sequence Analysis {ECO:0000255}; SQ MSLKPFTYPFPETRFLHAGTNVYKFKIRYGNSIRGEEIEDKGVIIQELEDSIRAVLANMDSLQPFVTEHFIVFPYKSKWE SQ RVSHLKFKHGEIILTPYPFVFTLYIEMKCFAESLPSGKPTDDIPLELVLTAKEAEEATMRKRKLMEEPSTPSRPGPHRAK SQ METWSEASSTKKALKEHKRSWGEDSQQDTPASDSTAVTEQDPMLGHSLPGLVVPPLEHSNPPPLKEPAARGFLGFLSALF SQ PFRYFFRKSTQ //