ID Q6CWX4; PN Dynein light chain 1, cytoplasmic; GN DYN2; OS 284590; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Cytoplasm, cytoskeleton {ECO:0000250|UniProtKB:Q02647}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q02647}. DR UNIPROT: Q6CWX4; DR Pfam: PF01221; DR PROSITE: PS01239; DE Function: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity). Also a component of the nuclear pore complex (By similarity). {ECO:0000250, ECO:0000250|UniProtKB:Q02647}. DE Reference Proteome: Yes; GO GO:0005868; GO GO:0005881; GO GO:0005643; GO GO:1990429; GO GO:0005777; GO GO:0008574; GO GO:0044877; GO GO:0040001; GO GO:0051028; GO GO:0030473; GO GO:0051292; GO GO:0015031; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MSKPVLKASDITDELRDEIFELSSNATANYKLEREIAAYIKKQLDVSQGETWHVIVGKNFGSYVTHEKGYFVYFYIGPLA SQ FLVFKTA //