ID Q6NW58; PN Spastin; GN spast; OS 7955; SL Nucleus Position: SL-0198; SL Comments: Membrane {ECO:0000255|HAMAP-Rule:MF_03021}; Peripheral membrane protein {ECO:0000255|HAMAP-Rule:MF_03021}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000255|HAMAP-Rule:MF_03021}. Cytoplasm, cytoskeleton {ECO:0000255|HAMAP-Rule:MF_03021}. Cytoplasm, perinuclear region {ECO:0000255|HAMAP-Rule:MF_03021}. Nucleus {ECO:0000255|HAMAP- Rule:MF_03021}. Note=Forms an intramembrane hairpin-like structure in the membrane. {ECO:0000255|HAMAP-Rule:MF_03021}. DR UNIPROT: Q6NW58; DR UNIPROT: Q6JUU0; DR Pfam: PF00004; DR Pfam: PF17862; DR Pfam: PF09336; DR PROSITE: PS00674; DE Function: ATP-dependent microtubule severing protein that specifically recognizes and cuts microtubules that are polyglutamylated. Preferentially recognizes and acts on microtubules decorated with short polyglutamate tails: severing activity increases as the number of glutamates per tubulin rises from one to eight, but decreases beyond this glutamylation threshold. Microtubule severing promotes reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. Also plays a role in axon growth and the formation of axonal branches. {ECO:0000255|HAMAP-Rule:MF_03021}. DE Reference Proteome: Yes; GO GO:1904115; GO GO:0005813; GO GO:0016021; GO GO:0005874; GO GO:0015630; GO GO:0030496; GO GO:0031965; GO GO:0005634; GO GO:0048471; GO GO:0005819; GO GO:0043014; GO GO:0005524; GO GO:0016887; GO GO:0048487; GO GO:0016853; GO GO:0008017; GO GO:0008568; GO GO:0008089; GO GO:0048675; GO GO:0007411; GO GO:0019896; GO GO:0007409; GO GO:0021955; GO GO:0032506; GO GO:0031122; GO GO:0006888; GO GO:0007032; GO GO:0010458; GO GO:0090148; GO GO:0001578; GO GO:0000226; GO GO:0051013; GO GO:0000281; GO GO:0051228; GO GO:0043066; GO GO:0031468; GO GO:0045773; GO GO:0031117; GO GO:0034214; GO GO:0051260; GO GO:0072593; TP Membrane Topology: Peripheral; Source: UniProt - Sequence Analysis {ECO:0000255|HAMAP-Rule:MF_03021}; SQ MNSGHKARLRGGRACGPVSDGSARGNRLLFYTRSLSRVPEWLLRVLLLLLRWLFQPIRRAMAARAKECGPDGSEETGERI SQ RNYHKQAFEFISVALQIDEDEKGDKQKAVQWYRKGIAELEKGIQIQVTGAGEKADRARKLQDKMITNLSMAEDRLKLLGN SQ LLSQSPAESSSDDSFYSFSNGNLRPAPASGAVSKKKDTLTITNQTSLRPKNPPKSTPNASGLNCTPSAAQSSRTGPQNNQ SQ KGPTVKGKNNVKASTTATASPQRKRDMKNFKNVDSKLASLILNEIVDSGSVVRFDDIAGQDLAKQALQEIVILPALRPEL SQ FTGLRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNISAATLTSKYVGEGEKLVRALFAVARELQPSIIFIDEIDSLL SQ CERREGEHDASRRLKTEFLIEFDGVQSGGDERVLVMGATNRPQELDEAVLRRFAKRIYVALPTEETRLKLLKNLLSKHRN SQ PLSQKELSQLARLTDGYSGSDLTSLAKDAALGPIRELKPEQVRNMSAHEMRDIRISDFLESLKRIKRSVSPQTLDQYVRW SQ NREYGDTTGV //