ID Q6P642; PN DnaJ homolog subfamily B member 6; GN dnajb6; OS 8364; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:O75190}. Nucleus {ECO:0000250|UniProtKB:O75190}. DR UNIPROT: Q6P642; DR Pfam: PF00226; DR PROSITE: PS00636; DR PROSITE: PS50076; DE Function: Plays an indispensable role in the organization of krt8/krt18 filaments. Acts as an endogenous molecular chaperone for neuronal proteins including huntingtin. Has a stimulatory effect on the ATPase activity of HSP70 in a dose-dependent and time-dependent manner and hence acts as a co-chaperone of HSP70 (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:0051087; GO GO:0044183; GO GO:0051082; GO GO:0061077; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MVEYYDVLGVQRNASPEDIKKAYRKLALKWHPDKNPDNKDEAERRFKEVAEAYEVLSDSKKRDIYDKYGKEGLTGGGGGS SQ HFDNPYEFGFTFRSPDDVFRDFFGGRDPFSFDLFADDPFDDFFGRRGHRANRSRPGGSFLSTFGGFPAFGPTFSPFDSGF SQ SSSFGSFGGHGGFSSFSSSSFGGSGMGNFRSVSTSTKVVNGRRVTTKRIVENGQERIEVEEDGQLKSLTINGKEQLLRLD SQ NK //