ID Q6P6X9; PN Nucleoporin NUP35; GN nup35; OS 7955; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q8NFH5}. DR UNIPROT: Q6P6X9; DR Pfam: PF05172; DR PROSITE: PS51472; DE Function: Functions as a component of the nuclear pore complex (NPC). NPC components, collectively referred to as nucleoporins (NUPs), can play the role of both NPC structural components and of docking or interaction partners for transiently associated nuclear transport factors (By similarity). {ECO:0000250}. DE Reference Proteome: Yes; GO GO:0031965; GO GO:0044613; GO GO:0044615; GO GO:0005543; GO GO:0003697; GO GO:0017056; GO GO:0051028; GO GO:0006607; GO GO:0006999; GO GO:0006355; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MEIQSCIEPMTLGSPTSPKPGAQFLPGFLMGDLPAPVTPQPRSFGLTGGAEIRSPLLAGGSPPQPVVPTPKDKSGAPPVR SQ SIYDDLNGSAVGMSPLAARKQPFAGVHTPLSGLQGTPGTVSNFFSPVSQQRKTTLSPAQVDPFFTQGDALSSEDQLDDTW SQ ITVFGFPPASASYILLQFAQYGNILKHVMSNTGNWMHVQYQSKLQARKALSKDGKIFGEAIMIGVKPCIDKSVMESLDKG SQ STSSSVFTPPVKAPCTPSHPLSTPRSVMRPLSAAYKASSSDYQVVSDQQTPKKDESFVSKAMEYMFGW //