ID Q6PC30; PN COP9 signalosome complex subunit 5; GN cops5; OS 7955; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, cytosol {ECO:0000250|UniProtKB:Q92905}. Nucleus {ECO:0000250|UniProtKB:Q92905}. Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:Q92905}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {ECO:0000250|UniProtKB:Q92905}. DR UNIPROT: Q6PC30; DR Pfam: PF18323; DR Pfam: PF01398; DR PROSITE: PS50249; DE Function: Probable protease subunit of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of E3 ligase complexes, leading to modify the Ubl ligase activity. In the complex, it probably acts as the catalytic center that mediates the cleavage of nedd8 from cullins. It however has no metalloprotease activity by itself and requires the other subunits of the CSN complex. {ECO:0000250|UniProtKB:Q92905}. DE Reference Proteome: Yes; GO GO:0070161; GO GO:0008180; GO GO:0005737; GO GO:0005829; GO GO:0005634; GO GO:0048471; GO GO:0008021; GO GO:0019784; GO GO:0046872; GO GO:0004222; GO GO:0008237; GO GO:0043066; GO GO:0051091; GO GO:0000338; GO GO:0060118; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MAGSSIAMKTWELSNSMQEVQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKLSALALLKMVMHARSGGNLEVMGLML SQ GKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQ SQ EPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLW SQ NKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQAEAQLGRGSFMLGLDTHDRKSEDKLAKATRDSCKTTIEAIHGLMSQV SQ IKDKLFNQVNTSAN //