ID Q6TGU2; PN Nucleoporin SEH1; GN seh1l; OS 7955; SL Nucleus Position: SL-0178; SL Nucleus Position: SL-0185; SL Comments: Chromosome, centromere, kinetochore {ECO:0000250|UniProtKB:Q96EE3}. Nucleus, nuclear pore complex {ECO:0000250|UniProtKB:Q96EE3}. Lysosome membrane {ECO:0000250|UniProtKB:Q96EE3}. DR UNIPROT: Q6TGU2; DR UNIPROT: Q1LXR9; DR Pfam: PF00400; DR PROSITE: PS50082; DR PROSITE: PS50294; DE Function: Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore. {ECO:0000250|UniProtKB:Q96EE3}. As a component of the GATOR complex may function in the amino acid-sensing branch of the TORC1 signaling pathway. {ECO:0000250|UniProtKB:Q96EE3}. DE Reference Proteome: Yes; GO GO:0000776; GO GO:0005765; GO GO:0031080; GO GO:0035859; GO GO:0005198; GO GO:0051315; GO GO:0051301; GO GO:0034198; GO GO:0007080; GO GO:0051028; GO GO:0006999; GO GO:1904263; GO GO:0015031; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MFVAKSIAADHKDLIHDVSYDFHGRRMATCSSDQSVKVWDKGDDGEWHCTASWKTHSGSVWRVTWAHPEFGQVLASCSFD SQ RTAAVWEEIVGESNDKQRGQSHWIKRTTLVDSRTSVTDVKFAPKHMGLMLTTCSADGVVRIYEAPDVMNLSQWSLQHEIS SQ CKLACSCISWNPSSSRAHPPMIAVGGDDSNGAYSGKVQIHEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHVLAI SQ ATKDVRIFKLLPLRRESANSSGPTKFEVQVMAQFDSHNSQVWRVSWNITSTLLASSGDDGCVRLWKANYMDNWKCTGILR SQ GDGSPVNGSSGPSAALSAVGVPGAAQMIVGAATAGRKKAQLMPG //