ID Q76IQ3; PN Tyrosine 3-monooxygenase; GN TH; OS 9615; SL Nucleus Position: SL-0198; SL Comments: Cytoplasm, perinuclear region {ECO:0000250|UniProtKB:P24529}. Nucleus {ECO:0000250|UniProtKB:P04177}. Cell projection, axon {ECO:0000250|UniProtKB:P24529}. Cytoplasm {ECO:0000250|UniProtKB:P04177}. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle {ECO:0000250|UniProtKB:P04177}. Note=When phosphorylated at Ser-19 shows a nuclear distribution and when phsphorylated at Ser-31 as well at Ser-40 shows a cytosolic distribution (By similarity). Expressed in dopaminergic axons and axon terminals (By similarity). {ECO:0000250|UniProtKB:P04177, ECO:0000250|UniProtKB:P07101}. DR UNIPROT: Q76IQ3; DR Pfam: PF00351; DR Pfam: PF12549; DR PROSITE: PS00367; DR PROSITE: PS51410; DE Function: Catalyzes the conversion of L-tyrosine to L- dihydroxyphenylalanine (L-Dopa), the rate-limiting step in the biosynthesis of cathecolamines, dopamine, noradrenaline, and adrenaline. Uses tetrahydrobiopterin and molecular oxygen to convert tyrosine to L-Dopa (By similarity). In addition to tyrosine, is able to catalyze the hydroxylation of phenylalanine and tryptophan with lower specificity (By similarity). Positively regulates the regression of retinal hyaloid vessels during postnatal development (By similarity). {ECO:0000250|UniProtKB:P04177, ECO:0000250|UniProtKB:P07101, ECO:0000250|UniProtKB:P24529}. DE Reference Proteome: Yes; GO GO:0070161; GO GO:0030424; GO GO:0005737; GO GO:0005634; GO GO:0048471; GO GO:0008021; GO GO:0005506; GO GO:0004511; GO GO:0009072; GO GO:0042416; GO GO:1990384; GO GO:0042136; TP Membrane Topology: Unknown; Source: UniProt - Sequence Analysis; SQ MPTPNTASPQAKGFRRAVSELDAKQAEAIMSPRFIGRRQSLIEDARKEREKAEAASAASSEPGDLLEAAVSKEKDGKAML SQ NLLFTLRGAKTSSLSRAVKAFETFEAQIHHLETRPVQRPRAGGPHLEYFVRCEVPSADLPALLSSVRRVAEDVRGAGENK SQ VLWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEIAFQYKHGDPIPRVEYTAEEIATWKEVYTTLKSL SQ YVTHACREHLEAFQLLERFSGYREDSIPQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMH SQ SPEPDCCHELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYGAGLLSSYGELLHS SQ LSEEPEIRAFDPDAAAVQPYQDQTYQSVYFVSESFSDAKDKLRNYASRIQRPFSVKFDPYTLAIDVLDSPHAIRRSLEGV SQ QDELHTLAHALSAIG //